Immune system
LL-37
Also known as: Cathelicidin, hCAP-18, Antimikrobielles Peptid
The only human cathelicidin peptide. LL-37 is a 37-amino-acid peptide with a broad antimicrobial spectrum and immunomodulatory properties.
Structure
- Sequence
- [LL-37, 37 aa]
- Molecular formula
- C₂₀₅H₃₄₀N₆₀O₅₃
- Molecular weight
- 4,493 Da
- Amino acids
- 37
- Half-life
- ~30 minutes (im Serum)
Mechanism of action
LL-37 inserts into microbial membranes and forms pores, which lyses pathogens. It also activates formyl peptide, toll-like and P2X7 receptors and so recruits immune cells.
Studies
More in Immune system
More detail (research areas, comparisons, FAQ): German lexicon entry.